PAN Pesticides Database - Chemicals

Home > Chemical Search
Help | Feedback  

Alkyl-1,3-propylene diamine adipate, alkyl derived from coconut oil fatty acids - Identification, toxicity, use, water pollution potential, ecological toxicity and regulatory information

Note: See Working with the Information on this Page section below for important notes about this data.

This database and website are updated and enhanced by Pesticide Action Network North America (PANNA). The project is made possible by our Sponsors and by PANNA general funds. We need your support to maintain and improve this system. Please support the database and website — donate to PANNA.

Chemical ID
 Identifying information, including synonyms, ID numbers, use type, chemical classification, a link to a list of all products containing this chemical and a list of the top crops this pesticide is used on in California.
Poisoning Symptoms
 Signs and symptoms of poisoning, first aid, and links to treatment information for this chemical.
Toxicity
 Toxicity to humans, including carcinogenicity, reproductive and developmental toxicity, neurotoxicity, and acute toxicity.
Regulatory
 Links to world-wide registration status as well as regulatory information for the U.S. and California.
Water
 Water quality standards and physical properties affecting water contamination potential.
Ecotoxicity
 Toxicity to aquatic organisms.
Related Chems
 List of chemicals in the same family, including breakdown products, salts, esters, isomers, and other derivatives.
 

Chemical Identification and Use for Alkyl-1,3-propylene diamine adipate, alkyl derived from coconut oil fatty acids
Basic Identification Information About This Chemical
Chemical Name: Alkyl-1,3-propylene diamine adipate, alkyl derived from coconut oil fatty acids
CAS Number: 68155-42-0
U.S. EPA PC Code: 169109
CA DPR Chem Code: 1841
Molecular Weight: 0
Use Type: Microbiocide , Soap/Surfactant
Chem Class: Alkyl Amino Propane
View Related Chemicals
 
Additional Resources About This Chemical Class and Use Type

See the Global Pesticide Resources page for many additional links.
 
Other Names for this Chemical
About Chemical Synonyms
01841 (CA DPR Chem Code) , 1-(Alkyl* amino)-3-aminopropane adipate *(as in fatty acids of coconut oil) , 169109 (US EPA PC Code) , 1841 (CA DPR Chem Code) , 68155-42-0 (CAS Number) , 68155420 , 68155420 (CAS Number) , ALKYL-1,3-PROPYLENE DIAMINE ADIPATE ALKYL DERIVEDFROM COCONUT OIL FATTY ACIDS , Alkyl-1,3-propylene diamine adipate, alkyl derived from coconut oil fatty acids , Alkyl13propylenediamineadipatealkylderivedfromcoconutoilfattyacids , Amines, N-coco alkyltrimethylenedi-, adipates , N-Alkyl*-1,3-propanediamine adipate *(as in fatty acids of coconut oil) , N-Alkyl*-1,3-propylenediamine adipate *(as in fatty acids of coconut oil) , N-Coco alkyltrimethylenediamines, adipates
 
Products Containing This Chemical
Current and historic U.S. registered products
View U.S. Products All Products Currently Registered Products
 

Signs and Symptoms of Alkyl-1,3-propylene diamine adipate, alkyl derived from coconut oil fatty acids Poisoning

NOTE! There may be other diseases and chemicals that have similar symptoms.

If you have a poisoning emergency in the United States call 1-800-222-1222.
If the victim has collapsed or is unconscious, call 911.

Sorry! No symptoms for this chemical or chemical group are available. See related chemicals for possible additional information.
 
 

Toxicity Information for Alkyl-1,3-propylene diamine adipate, alkyl derived from coconut oil fatty acids

  Note: Information for many chemicals is incomplete and may not be fully representative of effects on humans. Why?

Summary Toxicity Information

PAN Bad Actor
Chemical 1 		Acute
Toxicity 2 		Carcinogen Cholinesterase
Inhibitor 		Ground
Water Contaminant 		Developmental or
Reproductive Toxin 		Endocrine
Disruptor
Not Listed
No
 
Indicates high toxicity in the given toxicological category. Indicates no available weight-of-the-evidence summary assessment. For additional information on toxicity from scientific journals or registration documents, see the "Additional Resources for Toxicity " section of the chemical detail page.
1. PAN Bad Actors are chemicals that are one or more of the following: highly acutely toxic, cholinesterase inhibitor, known/probable carcinogen, known groundwater pollutant or known reproductive or developmental toxicant. NOTE! Because there are no authoritative lists of Endocrine Disrupting (ED) chemicals, EDs are not yet considered PAN Bad Actor chemicals.
2. The acute toxicity reported on this page is of the pure chemical ingredient only and may not reflect the acute toxicity of individual pesticide products. To view acute toxicity of individual products, click on 'View Products' link in the 'Chemical Identification' section above.

Additional Resources about the Toxicity of this Chemical

See the Global Pesticide Resources page for many additional links.

Detailed Toxicity Information
This Chemical
Parent Chemical 
Acute Toxicity 2
 Alkyl-1,3-propylene diamine adipate, alkyl derived from coconut oil fatty acids 1-(alkylamino)-3-aminopropane
WHO Acute Hazard
TRI Acute Hazard
Material Safety Data Sheets
Acute rating from U.S. EPA product label
U.S. NTP Acute Toxicity Studies
      View Studies
Cholinesterase Inhibitor		 Not Listed
Not Listed
Not Available
No Consensus Value
No NTP Studies

No 		Not Listed
Not Listed
Not Available
No Consensus Value
No NTP Studies

No
2. The acute toxicity reported on this page is of the pure chemical ingredient only and may not reflect the acute toxicity of individual pesticide products. To view acute toxicity of individual products, click on 'View Products' link in the 'Chemical Identification' section above.
 
Cancer Information
 Alkyl-1,3-propylene diamine adipate, alkyl derived from coconut oil fatty acids 1-(alkylamino)-3-aminopropane
IARC Carcinogens
U.S. NTP Carcinogens
California Prop 65 Known Carcinogens
U.S. EPA Carcinogens
TRI Carcinogen		 Not Listed
Not Listed
Not Listed
Not Listed
Not Listed		 Not Listed
Not Listed
Not Listed
Not Listed
Not Listed
 
Endocrine Disruption
 Alkyl-1,3-propylene diamine adipate, alkyl derived from coconut oil fatty acids 1-(alkylamino)-3-aminopropane
Illinois EPA list
Keith list
Colborn list
Benbrook list
Danish Inert list
EU list		 Not Listed
Not Listed
Not Listed
Not Listed
Not Listed
Not Listed		 Not Listed
Not Listed
Not Listed
Not Listed
Not Listed
Not Listed
 
Reproductive and Developmental Toxicity
 Alkyl-1,3-propylene diamine adipate, alkyl derived from coconut oil fatty acids 1-(alkylamino)-3-aminopropane
CA Prop 65 Developmental Toxin
U.S. TRI Developmental Toxin
CA Prop 65 Female Reproductive Toxin
CA Prop 65 Male Reproductive Toxin
U.S. TRI Reproductive Toxin 		Not Listed
Not Listed
Not Listed
Not Listed
Not Listed 		Not Listed
Not Listed
Not Listed
Not Listed
Not Listed
 
Chemicals of Special Concern
 Alkyl-1,3-propylene diamine adipate, alkyl derived from coconut oil fatty acids 1-(alkylamino)-3-aminopropane
PAN Bad Actors
PAN Dirty Dozen list		 Not Listed
Not Listed		 Not Listed
Not Listed
 

Water Pollution Potential and Criteria for Alkyl-1,3-propylene diamine adipate, alkyl derived from coconut oil fatty acids

Water Pollution Potential

This Chemical
Parent Chemical
  Alkyl-1,3-propylene diamine adipate, alkyl derived from coconut oil fatty acids 1-(alkylamino)-3-aminopropane
PAN Ground Water Contaminant Rating Insufficient Data Insufficient Data
 

Sorry, no water quality standards or criteria have been established for this chemical by the U.S. or Canadian governments; however, there may be criteria established for related chemicals.
 

Regulatory Information for Alkyl-1,3-propylene diamine adipate, alkyl derived from coconut oil fatty acids

International Regulatory Status
This Chemical
Parent Chemical 
Registration in Selected Countries Registration in Selected Countries:
Alkyl-1,3-propylene diamine adipate, alkyl derived from coconut oil fatty acids
 Registration for Selected Countries:
1-(alkylamino)-3-aminopropane
 
UNEP Persistent Organic Pollutant (POP)
UNEP Prior Informed Consent Chemical (PIC)
WHO Obsolete Pesticide		 Not Listed
Not Listed
Not Listed		 Not Listed
Not Listed
Not Listed
 

U.S. and California Regulatory Status
U.S. EPA Registered
U.S. EPA Hazardous Air Pollutant
U.S. EPA Minimum Risk Pesticide (25b list)

CA Registered
CA Groundwater Contaminant
CA Toxic Air Contaminant 		No
Not Listed
No

No
Not Listed
Not Listed 		Yes
Not Listed
No

Yes
Not Listed
Not Listed
 

Maximum Tolerance and Residue Levels
Codex Alimentarius
   (UN FAO Maximum Residue Limits)
U.S. Maximum Tolerance Levels
European Union Maximum Residue Levels 		Go to web site

Go to web site
Go to web site
 

Ecotoxicity for Alkyl-1,3-propylene diamine adipate, alkyl derived from coconut oil fatty acids

Note! Information for many chemicals is incomplete and may not be fully representative of effects on the environment. Why? Click on underlined terms for definitions and additional information.

Aquatic Ecotoxicity
All Toxic Effects for Organism Group
Organism Group Effects Noted

Sorry, no ecotoxicity data available for this chemical. Try related chemicals.
 
Summary of Acute Toxicity for Organism Group

Sorry, no acute ecotoxicity data available for this chemical. Try related chemicals.
 

Terrestrial Ecotoxicity

We are seeking funding to incorporate terrestrial ecotoxicity data analogous to the aquatic ecotoxicity data in the space above. Watch this space!

Related Chemicals for Alkyl-1,3-propylene diamine adipate, alkyl derived from coconut oil fatty acids
CAS Number Relation Reason Chemical Name Chem Detail Registration Symptoms California Use Chem Use Type U.S. EPA Reg PAN Bad Actor
68155-37-3, 68439-71-4 Parent P 1-(alkylamino)-3-aminopropane View View View View Microbiocide Yes Not Listed
2372-82-9 Related 2 1,3-Propanediamine, N-(3-aminopropyl)-N-dodecyl- View View View View Microbiocide Yes Not Listed
61791-67-1 Related 2 1-(Alkyl* amino)-3-aminopropane *(47%C12, 18%C14, 10%C18, 9%C10, 8%C16, 8%C8) View View View View Microbiocide No Not Listed
61791-63-7 Related 2 1-(Alkyl* amino)-3-aminopropane *(as in fatty acids of coconut oil) View View View View Microbiocide Yes Yes
68911-78-4 Related 2 1-(Alkyl* amino)-3-aminopropane diacetate *(37%C18', 29%C16, 23%C18, 3%C16', 3%C14, 1.5%C18", 1%C14', 1%C12, 0.5%C15) View View View View Microbiocide No Not Listed
Related 2 1-(Alkyl* amino)-3-aminopropane diacetate *(as in fatty acids of coconut oil) View View View View Microbiocide Yes Not Listed
Related 2 1-(Alkyl* amino)-3-aminopropane monoacetate *(47%C12, 18%C14, 10%C18, 9%C10, 8%C16, 8%C8) View View View View Microbiocide, Algaecide No Not Listed
Related 2 1-(Alkyl* amino)-3-aminopropane propionate-copper acetate complex View View View View Microbiocide No Not Listed
Related 2 1-(alkyl-amino)-3-aminopropane hydrochloride View View View View Microbiocide No Not Listed
Related 2 1-Alkyl (C6 to C18) amino-3-aminopropane acetate View View View View Microbiocide No Not Listed
61791-64-8 Related 2 1-alkylamino-2-aminopropane monoacetate, alkyl derived from coconut oil fatty acids View View View View Microbiocide Yes Not Listed
68155-43-1 Related 2 1-Alkylamino-3-aminopropane hydroxyacetate, alkyl derived from coconut oil fatty acids View View View View Microbiocide, Soap/Surfactant Yes Not Listed
61791-58-0 Related 2 Alkyl (53%C12, 19%C14, 8.5%C16, 7%C8, 6.5%C10, 6%C18)-1,3-propane diamine View View View View Microbiocide No Not Listed
68155-42-0 Related 2 Alkyl-1,3-propylene diamine adipate, alkyl derived from coconut oil fatty acids View View View View Microbiocide, Soap/Surfactant No Not Listed
Related 2 N-((1-Alkyl* ethyl)-1,3-propanediamine) *(as in fatty acids of cottonseed oil) View View View View Microbiocide No Not Listed
68188-29-4 Related 2 N-Alkyl-1,3-propylene diamine monobenzoate, alkyl derived from coconut oil fatty acids View View View View Microbiocide, Soap/Surfactant No Not Listed
83542-86-3 Related 2 N-octadecenyl-1,3-propane diamine monogluconate View View View View Microbiocide No Not Listed
61790-55-4 Related 2 Tall oil fatty acid soap of N-alkyl (C16-C18) propyl diamine View View View View Microbiocide, Insecticide No Not Listed
 
Working with the Information on this Page

Click on underlined terms for definitions or go to the Pesticide Tutorial overview page.

Any underlined term with a book icon has additional information.

* Data marked with an asterisk indicates that this chemical is not explicitly listed on the corresponding list. Instead, it belongs to a group of chemicals that IS designated on the list. For example, if an agency assigns a classification of reproductive toxicant to "mercury compounds", that classification is applied to all mercury compounds in the PAN Pesticide database, which are then marked with an asterisk.

To print this page, choose Print. To export this data, choose Save As 'HTML Source' and open it in Excel or equivalent program.

 
 
Citation: Kegley, S.E., Hill, B.R., Orme S., Choi A.H., PAN Pesticide Database, Pesticide Action Network, North America (San Francisco, CA, 2009), http:www.pesticideinfo.org.
© 2000-2009 Pesticide Action Network, North America. All rights reserved.